PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G005000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YB
Protein Properties Length: 229aa    MW: 25608.6 Da    PI: 6.9567
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G005000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB173.81.8e-5450146197
               NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                         vreqdrf+Pianv+rim+k+lP++akis+daket+qecvse+isf+tsea+++cqre+rkti+++d+l+a+++lGf+dy+epl++yl++yr
  Potri.006G005000.1  50 VREQDRFMPIANVIRIMRKILPSHAKISDDAKETIQECVSEYISFITSEANERCQREQRKTITAEDVLYAMSKLGFDDYIEPLTIYLHRYR 140
                         69***************************************************************************************** PP

               NF-YB  92 elegek 97 
                         elege+
  Potri.006G005000.1 141 ELEGER 146
                         ****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.5E-5146162IPR009072Histone-fold
SuperFamilySSF471134.97E-3953150IPR009072Histone-fold
PfamPF008081.5E-2556120IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-1784102No hitNo description
PROSITE patternPS00685087103IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.8E-17103121No hitNo description
PRINTSPR006151.8E-17122140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MDRRGGFHGY RKLLNTSSEI NMRLTAEINH NSSSNSNVHV TTDDINECTV REQDRFMPIA  60
NVIRIMRKIL PSHAKISDDA KETIQECVSE YISFITSEAN ERCQREQRKT ITAEDVLYAM  120
SKLGFDDYIE PLTIYLHRYR ELEGERSSMR CEPLVKSTRN NNNNVDQFGA MAGVGAYAPA  180
FHVSHHHHGF FGGSPIGAGY MNTRDATPNA SSSHAAALAN VEAFAQHK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-4049141193NF-YB
4awl_B1e-4049141294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-4049141294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2101291e-179AC210129.1 Populus trichocarpa clone POP009-F11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002415.11e-137PREDICTED: nuclear transcription factor Y subunit B-6
SwissprotQ84W665e-74NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLB9HC291e-121B9HC29_POPTR; Uncharacterized protein
STRINGPOPTR_0006s00690.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.11e-72nuclear factor Y, subunit B6